FBLN3 antibody (Middle Region)

Catalog No. ABIN630948

The Rabbit Polyclonal anti-FBLN3 antibody (ABIN630948) specifically detects FBLN3 in WB. The antibody is reactive with Human samples.

Quick Overview for FBLN3 antibody (Middle Region) (ABIN630948)

Target: FBLN3 (Fibulin 3 (FBLN3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBLN3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBLN3 Antibody

Binding Specificity: Middle Region

Specificity: EFEMP1 antibody was raised against the middle region of EFEMP1

Purification: Affinity purified

Immunogen: EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EFEMP1 Blocking Peptide, (ABIN5613311), is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBLN3

Target: FBLN3 (Fibulin 3 (FBLN3))

Alternative Name: EFEMP1

Background: EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway