PRODH2 antibody

Catalog No. ABIN630971

The Rabbit Polyclonal anti-PRODH2 antibody has been validated for WB and IHC. It is suitable to detect PRODH2 in samples from Human and Dog.

Quick Overview for PRODH2 antibody (ABIN630971)

Target: PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRODH2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PRODH2 Antibody

Purification: Affinity purified

Immunogen: PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRODH2 Blocking Peptide, (ABIN940362), is also available for use as a blocking control in assays to test for specificity of this PRODH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRODH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRODH2

Target: PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))

Alternative Name: PRODH2

Background: PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.

Molecular Weight: 59 kDa (MW of target protein)