DLGAP5 antibody (N-Term)

Catalog No. ABIN630974

The Rabbit Polyclonal anti-DLGAP5 antibody has been validated for WB. It is suitable to detect DLGAP5 in samples from Human and Mouse.

Quick Overview for DLGAP5 antibody (N-Term) (ABIN630974)

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLGAP5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLGAP5 Antibody

Binding Specificity: N-Term

Specificity: DLG7 antibody was raised against the N terminal Of Dlg7

Purification: Affinity purified

Immunogen: DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLG7 Blocking Peptide, (ABIN938206), is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLGAP5

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Alternative Name: DLG7

Background: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

Molecular Weight: 95 kDa (MW of target protein)

Pathways: M Phase