WBP2NL antibody (N-Term)

Catalog No. ABIN630989

The Rabbit Polyclonal anti-WBP2NL antibody has been validated for WB. It is suitable to detect WBP2NL in samples from Human.

Quick Overview for WBP2NL antibody (N-Term) (ABIN630989)

Target: WBP2NL (WBP2 N-terminal Like (WBP2NL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WBP2NL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WBP2NL Antibody

Binding Specificity: N-Term

Specificity: WBP2 NL antibody was raised against the N terminal of WBP2 L

Purification: Affinity purified

Immunogen: WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WBP2NL Blocking Peptide, (ABIN5616991), is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP0 L antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WBP2NL

Target: WBP2NL (WBP2 N-terminal Like (WBP2NL))

Alternative Name: WBP2NL

Background: WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Molecular Weight: 32 kDa (MW of target protein)