WBP2NL antibody (N-Term)
-
- Target See all WBP2NL Antibodies
- WBP2NL (WBP2 N-terminal Like (WBP2NL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WBP2NL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WBP2 NL antibody was raised against the N terminal of WBP2 L
- Purification
- Affinity purified
- Immunogen
- WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
- Top Product
- Discover our top product WBP2NL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WBP2NL Blocking Peptide, catalog no. 33R-5799, is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP0 L antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WBP2NL (WBP2 N-terminal Like (WBP2NL))
- Alternative Name
- WBP2NL (WBP2NL Products)
- Synonyms
- pawp antibody, PAWP antibody, 4930521I23Rik antibody, WBP2 N-terminal like antibody, WBP2 N-terminal like L homeolog antibody, Wbp2nl antibody, wbp2nl.L antibody, wbp2nl antibody, WBP2NL antibody
- Background
- WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.
- Molecular Weight
- 32 kDa (MW of target protein)
-