Lamin B2 antibody (N-Term)

Catalog No. ABIN630994

This Rabbit Polyclonal antibody specifically detects Lamin B2 in WB. It exhibits reactivity toward Human.

Quick Overview for Lamin B2 antibody (N-Term) (ABIN630994)

Target: Lamin B2 (LMNB2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lamin B2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Lamin B2 Antibody

Binding Specificity: N-Term

Specificity: Lamin B2 antibody was raised against the N terminal of LMNB2

Purification: Affinity purified

Immunogen: Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lamin B2 Blocking Peptide, (ABIN5614408), is also available for use as a blocking control in assays to test for specificity of this Lamin B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lamin B2

Target: Lamin B2 (LMNB2)

Alternative Name: Lamin B2

Background: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Apoptosis, Caspase Cascade in Apoptosis