MRPL37 antibody (N-Term)

Catalog No. ABIN630997

This Rabbit Polyclonal antibody specifically detects MRPL37 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MRPL37 antibody (N-Term) (ABIN630997)

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL37 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MRPL37 Antibody

Binding Specificity: N-Term

Specificity: MRPL37 antibody was raised against the N terminal of MRPL37

Purification: Affinity purified

Immunogen: MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL37 Blocking Peptide, (ABIN5614842), is also available for use as a blocking control in assays to test for specificity of this MRPL37 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL37

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Alternative Name: MRPL37

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molecular Weight: 48 kDa (MW of target protein)