Prohibitin 2 antibody (N-Term)
-
- Target See all Prohibitin 2 (PHB2) Antibodies
- Prohibitin 2 (PHB2)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Prohibitin 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Prohibitin 2 antibody was raised against the N terminal of PHB2
- Purification
- Affinity purified
- Immunogen
- Prohibitin 2 antibody was raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR
- Top Product
- Discover our top product PHB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Prohibitin 2 Blocking Peptide, catalog no. 33R-9946, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Prohibitin 2 (PHB2)
- Alternative Name
- Prohibitin 2 (PHB2 Products)
- Background
- PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-