TST antibody

Catalog No. ABIN631012

This Rabbit Polyclonal antibody specifically detects TST in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for TST antibody (ABIN631012)

Target: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TST antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TST Antibody

Purification: Affinity purified

Immunogen: TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TST Blocking Peptide, (ABIN938615), is also available for use as a blocking control in assays to test for specificity of this TST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TST

Target: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Alternative Name: TST

Background: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Molecular Weight: 33 kDa (MW of target protein)