LACTB antibody (C-Term)

Catalog No. ABIN631015

This Rabbit Polyclonal antibody specifically detects LACTB in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LACTB antibody (C-Term) (ABIN631015)

Target: LACTB (Lactamase, beta (LACTB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACTB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LACTB Antibody

Binding Specificity: C-Term

Specificity: Beta Lactamase antibody was raised against the C terminal of LACTB

Purification: Affinity purified

Immunogen: Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Lactamase Blocking Peptide, (ABIN5612321), is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACTB

Target: LACTB (Lactamase, beta (LACTB))

Alternative Name: beta Lactamase

Background: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Molecular Weight: 61 kDa (MW of target protein)