RPS3A antibody (N-Term)

Catalog No. ABIN631017

This anti-RPS3A antibody is a Rabbit Polyclonal antibody detecting RPS3A in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RPS3A antibody (N-Term) (ABIN631017)

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS3A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS3A Antibody

Binding Specificity: N-Term

Specificity: RPS3 A antibody was raised against the N terminal of RPS3

Purification: Affinity purified

Immunogen: RPS3 A antibody was raised using the N terminal of RPS3 corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS3A Blocking Peptide, (ABIN936800), is also available for use as a blocking control in assays to test for specificity of this RPS3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS3A

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Alternative Name: RPS3A

Background: RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 30 kDa (MW of target protein)