ACO2 antibody (Middle Region)
-
- Target See all ACO2 Antibodies
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACO2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACO2 antibody was raised against the middle region of ACO2
- Purification
- Affinity purified
- Immunogen
- ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
- Top Product
- Discover our top product ACO2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACO2 Blocking Peptide, catalog no. 33R-8284, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
- Alternative Name
- ACO2 (ACO2 Products)
- Synonyms
- DDBDRAFT_0206187 antibody, DDBDRAFT_0230168 antibody, DDB_0206187 antibody, DDB_0230168 antibody, aconitase 2 antibody, F10M23.310 antibody, F10M23_310 antibody, ACONM antibody, ICRD antibody, Aco-2 antibody, Aco3 antibody, D10Wsu183e antibody, cb1017 antibody, wu:fa10e03 antibody, wu:fb69g04 antibody, wu:fc20c11 antibody, aconitase 2 antibody, aconitase 2 S homeolog antibody, aconitate hydratase, mitochondrial antibody, aconitase, mitochondrial antibody, mitochondrial aconitate hydratase antibody, aconitase 2, mitochondrial antibody, Probable aconitate hydratase, mitochondrial antibody, ACO2 antibody, aco2.S antibody, Bm1_07420 antibody, aco2 antibody, ach1 antibody, Aco2 antibody, aco-2 antibody
- Background
- ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
- Molecular Weight
- 82 kDa (MW of target protein)
-