DLD antibody (Middle Region)

Catalog No. ABIN631024

This Rabbit Polyclonal antibody specifically detects DLD in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for DLD antibody (Middle Region) (ABIN631024)

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLD Antibody

Binding Specificity: Middle Region

Specificity: DLD antibody was raised against the middle region of DLD

Purification: Affinity purified

Immunogen: DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLD Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLD

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Alternative Name: DLD

Background: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis