ACAT1 antibody (Middle Region)
-
- Target See all ACAT1 Antibodies
- ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACAT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACAT1 antibody was raised against the middle region of ACAT1
- Purification
- Affinity purified
- Immunogen
- ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH
- Top Product
- Discover our top product ACAT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACAT1 Blocking Peptide, catalog no. 33R-3310, is also available for use as a blocking control in assays to test for specificity of this ACAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))
- Alternative Name
- ACAT1 (ACAT1 Products)
- Background
- ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.
- Molecular Weight
- 41 kDa (MW of target protein)
-