ACAT1 antibody (Middle Region)

Catalog No. ABIN631041

This anti-ACAT1 antibody is a Rabbit Polyclonal antibody detecting ACAT1 in WB. Suitable for Human.

Quick Overview for ACAT1 antibody (Middle Region) (ABIN631041)

Target: ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACAT1 Antibody

Binding Specificity: Middle Region

Specificity: ACAT1 antibody was raised against the middle region of ACAT1

Purification: Affinity purified

Immunogen: ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACAT1 Blocking Peptide, (ABIN938696), is also available for use as a blocking control in assays to test for specificity of this ACAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACAT1

Target: ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))

Alternative Name: ACAT1

Background: ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Molecular Weight: 41 kDa (MW of target protein)