AIFM3 antibody (Middle Region)

Catalog No. ABIN631043

Product Details anti-AIFM3 Antibody

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIFM3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AIFM3 antibody was raised against the middle region of AIFM3

Purification: Affinity purified

Immunogen: AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AIFM3

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Alternative Name: AIFM3 (AIFM3 Products)

Synonyms: nfrl-A antibody, MGC84340 antibody, AIFM3 antibody, LOC100150876 antibody, 2810401C16Rik antibody, AI840249 antibody, Aifl antibody, RGD1306028 antibody, AIFL antibody, apoptosis inducing factor, mitochondria associated 3 L homeolog antibody, apoptosis inducing factor, mitochondria associated 3 antibody, apoptosis-inducing factor, mitochondrion-associated 3 antibody, aifm3.L antibody, AIFM3 antibody, aifm3 antibody, Aifm3 antibody

Background: AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis