DBNL antibody (Middle Region)

Catalog No. ABIN631047

Product Details anti-DBNL Antibody

Target: DBNL (Drebrin-Like (DBNL))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DBNL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DBNL antibody was raised against the middle region of DBNL

Purification: Affinity purified

Immunogen: DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DBNL Blocking Peptide, catalog no. 33R-7539, is also available for use as a blocking control in assays to test for specificity of this DBNL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBNL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DBNL

Target: DBNL (Drebrin-Like (DBNL))

Alternative Name: DBNL (DBNL Products)

Synonyms: ABP1 antibody, HIP-55 antibody, HIP55 antibody, SH3P7 antibody, Abp1 antibody, mAbp1 antibody, Sh3p7 antibody, abp1 antibody, dbnl-B antibody, DBNL antibody, DKFZp459C0939 antibody, drebrin like antibody, drebrin-like antibody, drebrin like S homeolog antibody, drebrin 1 antibody, DBNL antibody, Dbnl antibody, dbnl.S antibody, LOC100148204 antibody, DBN1 antibody

Background: DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: TCR Signaling, Regulation of Actin Filament Polymerization