HIBADH antibody (Middle Region)

Catalog No. ABIN631048

This Rabbit Polyclonal antibody specifically detects HIBADH in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for HIBADH antibody (Middle Region) (ABIN631048)

Target: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIBADH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HIBADH Antibody

Binding Specificity: Middle Region

Specificity: HIBADH antibody was raised against the middle region of HIBADH

Purification: Affinity purified

Immunogen: HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIBADH Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIBADH

Target: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Alternative Name: HIBADH

Background: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.

Molecular Weight: 35 kDa (MW of target protein)