HIBADH antibody (Middle Region)
-
- Target See all HIBADH Antibodies
- HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HIBADH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HIBADH antibody was raised against the middle region of HIBADH
- Purification
- Affinity purified
- Immunogen
- HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG
- Top Product
- Discover our top product HIBADH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HIBADH Blocking Peptide, catalog no. 33R-1292, is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))
- Alternative Name
- HIBADH (HIBADH Products)
- Synonyms
- NS5ATP1 antibody, 6430402H10Rik antibody, AI265272 antibody, hibadh antibody, zgc:66262 antibody, wu:fb07f02 antibody, zgc:100804 antibody, 3-hydroxyisobutyrate dehydrogenase antibody, 3-hydroxyisobutyrate dehydrogenase b antibody, 3-hydroxyisobutyrate dehydrogenase S homeolog antibody, 3-hydroxyisobutyrate dehydrogenase a antibody, HIBADH antibody, Hibadh antibody, hibadhb antibody, hibadh.S antibody, hibadha antibody
- Background
- 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.
- Molecular Weight
- 35 kDa (MW of target protein)
-