HIBADH antibody (Middle Region)

Catalog No. ABIN631048

Product Details anti-HIBADH Antibody

Target: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIBADH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HIBADH antibody was raised against the middle region of HIBADH

Purification: Affinity purified

Immunogen: HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIBADH Blocking Peptide, catalog no. 33R-1292, is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIBADH

Target: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Alternative Name: HIBADH (HIBADH Products)

Synonyms: NS5ATP1 antibody, 6430402H10Rik antibody, AI265272 antibody, hibadh antibody, zgc:66262 antibody, wu:fb07f02 antibody, zgc:100804 antibody, 3-hydroxyisobutyrate dehydrogenase antibody, 3-hydroxyisobutyrate dehydrogenase b antibody, 3-hydroxyisobutyrate dehydrogenase S homeolog antibody, 3-hydroxyisobutyrate dehydrogenase a antibody, HIBADH antibody, Hibadh antibody, hibadhb antibody, hibadh.S antibody, hibadha antibody

Background: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.

Molecular Weight: 35 kDa (MW of target protein)