FTCD antibody (Middle Region)

Catalog No. ABIN631049

Product Details anti-FTCD Antibody

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FTCD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FTCD antibody was raised against the middle region of FTCD

Purification: Affinity purified

Immunogen: FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTCD Blocking Peptide, catalog no. 33R-4373, is also available for use as a blocking control in assays to test for specificity of this FTCD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FTCD

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Alternative Name: FTCD (FTCD Products)

Synonyms: LCHC1 antibody, FTCD antibody, wu:fp37b11 antibody, zgc:63647 antibody, formimidoyltransferase cyclodeaminase antibody, formiminotransferase cyclodeaminase antibody, formiminotransferase-cyclodeaminase antibody, formimidoyltransferase cyclodeaminase L homeolog antibody, FTCD antibody, Ftcd antibody, ftcd antibody, DP2350 antibody, Cbei_0990 antibody, TRQ2_1223 antibody, GAU_0899 antibody, ftcd.L antibody

Background: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Molecular Weight: 59 kDa (MW of target protein)