TMLHE antibody (Middle Region)

Catalog No. ABIN631052

Product Details anti-TMLHE Antibody

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMLHE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMLHE antibody was raised against the middle region of TMLHE

Purification: Affinity purified

Immunogen: TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMLHE Blocking Peptide, catalog no. 33R-7434, is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMLHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMLHE

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Alternative Name: TMLHE (TMLHE Products)

Synonyms: AUTSX6 antibody, BBOX2 antibody, TMLD antibody, TMLH antibody, TMLHED antibody, XAP130 antibody, Bbox2 antibody, D430017M14Rik antibody, Tmlh antibody, trimethyllysine dioxygenase, mitochondrial antibody, trimethyllysine hydroxylase, epsilon antibody, trimethyllysine hydroxylase, epsilon L homeolog antibody, LOC465953 antibody, TMLHE antibody, tmlhe antibody, tmlhe.L antibody, Tmlhe antibody

Background: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Molecular Weight: 49 kDa (MW of target protein)