Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (N-Term) antibody
-
- Target
- Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACADM antibody was raised against the N terminal of ACADM
- Purification
- Affinity purified
- Immunogen
- ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACADM Blocking Peptide, catalog no. 33R-1020, is also available for use as a blocking control in assays to test for specificity of this ACADM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial
- Alternative Name
- ACADM
- Background
- ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.
- Molecular Weight
- 46 kDa (MW of target protein)
-