ACADS antibody (N-Term)

Catalog No. ABIN631058

The Rabbit Polyclonal anti-ACADS antibody has been validated for WB. It is suitable to detect ACADS in samples from Human, Mouse and Rat.

Quick Overview for ACADS antibody (N-Term) (ABIN631058)

Target: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACADS Antibody

Binding Specificity: N-Term

Specificity: ACADS antibody was raised against the N terminal of ACADS

Purification: Affinity purified

Immunogen: ACADS antibody was raised using the N terminal of ACADS corresponding to a region with amino acids ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADS Blocking Peptide, (ABIN936921), is also available for use as a blocking control in assays to test for specificity of this ACADS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACADS

Target: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Alternative Name: ACADS

Background: ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process