HADH antibody (C-Term)

Catalog No. ABIN631059

This anti-HADH antibody is a Rabbit Polyclonal antibody detecting HADH in WB. Suitable for Human, Mouse, Rat.

Quick Overview for HADH antibody (C-Term) (ABIN631059)

Target: HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HADH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HADH Antibody

Binding Specificity: C-Term

Specificity: HADH antibody was raised against the C terminal of HADH

Purification: Affinity purified

Immunogen: HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HADH Blocking Peptide, catalog no. 33R-10203, is also available for use as a blocking control in assays to test for specificity of this HADH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HADH

Target: HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))

Alternative Name: HADH

Background: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Monocarboxylic Acid Catabolic Process