Catenin antibody

Catalog No. ABIN631064

The Rabbit Polyclonal anti-Catenin antibody has been validated for WB. It is suitable to detect Catenin in samples from Human.

Quick Overview for Catenin antibody (ABIN631064)

Target: Catenin

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Catenin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Catenin Antibody

Purification: Affinity purified

Immunogen: Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Catenin Blocking Peptide, (ABIN5612668), is also available for use as a blocking control in assays to test for specificity of this Catenin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Catenin

Target: Catenin

Background: This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.

Molecular Weight: 108 kDa (MW of target protein)