DLAT antibody (C-Term)

Catalog No. ABIN631076

The Rabbit Polyclonal anti-DLAT antibody has been validated for WB. It is suitable to detect DLAT in samples from Human, Mouse, Rat and C. elegans.

Quick Overview for DLAT antibody (C-Term) (ABIN631076)

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLAT Antibody

Binding Specificity: C-Term

Specificity: DLAT antibody was raised against the C terminal of DLAT

Purification: Affinity purified

Immunogen: DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLAT Blocking Peptide, (ABIN937613), is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLAT

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Alternative Name: DLAT

Background: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Molecular Weight: 69 kDa (MW of target protein)