WDR8 antibody (Middle Region)

Catalog No. ABIN631094

The Rabbit Polyclonal anti-WDR8 antibody has been validated for WB. It is suitable to detect WDR8 in samples from Human.

Quick Overview for WDR8 antibody (Middle Region) (ABIN631094)

Target: WDR8 (WD Repeat Domain 8 (WDR8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR8 Antibody

Binding Specificity: Middle Region

Specificity: WDR8 antibody was raised against the middle region of WDR8

Purification: Affinity purified

Immunogen: WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR8 Blocking Peptide, (ABIN938574), is also available for use as a blocking control in assays to test for specificity of this WDR8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR8

Target: WDR8 (WD Repeat Domain 8 (WDR8))

Alternative Name: WDR8

Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD).

Molecular Weight: 51 kDa (MW of target protein)