LACTB antibody (Middle Region)

Catalog No. ABIN631100

The Rabbit Polyclonal anti-LACTB antibody has been validated for WB. It is suitable to detect LACTB in samples from Human.

Quick Overview for LACTB antibody (Middle Region) (ABIN631100)

Target: LACTB (Lactamase, beta (LACTB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACTB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LACTB Antibody

Binding Specificity: Middle Region

Specificity: Beta Lactamase antibody was raised against the middle region of LACTB

Purification: Affinity purified

Immunogen: Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Lactamase Blocking Peptide, (ABIN5612320), is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACTB

Target: LACTB (Lactamase, beta (LACTB))

Alternative Name: beta Lactamase

Background: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Molecular Weight: 41 kDa (MW of target protein)