ACADSB antibody (Middle Region)

Catalog No. ABIN631104

This anti-ACADSB antibody is a Rabbit Polyclonal antibody detecting ACADSB in WB. Suitable for Human, Rat and Mouse.

Quick Overview for ACADSB antibody (Middle Region) (ABIN631104)

Target: ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADSB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACADSB Antibody

Binding Specificity: Middle Region

Specificity: ACADSB antibody was raised against the middle region of ACADSB

Purification: Affinity purified

Immunogen: ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADSB Blocking Peptide, (ABIN938802), is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACADSB

Target: ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))

Alternative Name: ACADSB

Background: Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process