MTCH2 antibody

Catalog No. ABIN631106

The Rabbit Polyclonal anti-MTCH2 antibody has been validated for WB. It is suitable to detect MTCH2 in samples from Human, Mouse and Rat.

Quick Overview for MTCH2 antibody (ABIN631106)

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTCH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTCH2 Antibody

Purification: Affinity purified

Immunogen: MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTCH2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTCH2

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Alternative Name: MTCH2

Background: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Molecular Weight: 33 kDa (MW of target protein)