RPS21 antibody (N-Term)

Catalog No. ABIN631108

This Rabbit Polyclonal antibody specifically detects RPS21 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPS21 antibody (N-Term) (ABIN631108)

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS21 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS21 Antibody

Binding Specificity: N-Term

Specificity: RPS21 antibody was raised against the N terminal of RPS21

Purification: Affinity purified

Immunogen: RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS21 Blocking Peptide, (ABIN5615947), is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS21

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Alternative Name: RPS21

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 9 kDa (MW of target protein)