TUFM antibody (Middle Region)

Catalog No. ABIN631117

This Rabbit Polyclonal antibody specifically detects TUFM in WB. It exhibits reactivity toward Human.

Quick Overview for TUFM antibody (Middle Region) (ABIN631117)

Target: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUFM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TUFM Antibody

Binding Specificity: Middle Region

Specificity: TUFM antibody was raised against the middle region of TUFM

Purification: Affinity purified

Immunogen: TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TUFM Blocking Peptide, (ABIN5616846), is also available for use as a blocking control in assays to test for specificity of this TUFM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUFM

Target: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Alternative Name: TUFM

Background: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.

Molecular Weight: 50 kDa (MW of target protein)