PACRG antibody (Middle Region)

Catalog No. ABIN631123

Product Details anti-PACRG Antibody

Target: PACRG (PARK2 Co-Regulated (PACRG))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PACRG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PACRG antibody was raised against the middle region of PACRG

Purification: Affinity purified

Immunogen: PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PACRG

Target: PACRG (PARK2 Co-Regulated (PACRG))

Alternative Name: PACRG (PACRG Products)

Synonyms: PACRG antibody, GLUP antibody, HAK005771 antibody, PARK2CRG antibody, RP3-495O10.2 antibody, zgc:101786 antibody, RGD1561027 antibody, 1700008H23Rik antibody, parkin coregulated antibody, PARK2 co-regulated antibody, PARK2 coregulated antibody, PACRG antibody, pacrg antibody, Pacrg antibody

Background: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Molecular Weight: 33 kDa (MW of target protein)