TXNDC5 antibody (N-Term)

Catalog No. ABIN631124

The Rabbit Polyclonal anti-TXNDC5 antibody has been validated for WB. It is suitable to detect TXNDC5 in samples from Human.

Quick Overview for TXNDC5 antibody (N-Term) (ABIN631124)

Target: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXNDC5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TXNDC5 Antibody

Binding Specificity: N-Term

Specificity: TXNDC5 antibody was raised against the N terminal of TXNDC5

Purification: Affinity purified

Immunogen: TXNDC5 antibody was raised using the N terminal of TXNDC5 corresponding to a region with amino acids ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNDC5 Blocking Peptide, (ABIN936846), is also available for use as a blocking control in assays to test for specificity of this TXNDC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXNDC5

Target: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Alternative Name: TXNDC5

Background: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis