Caveolin-1 antibody (N-Term)
-
- Target See all Caveolin-1 (CAV1) Antibodies
- Caveolin-1 (CAV1) (Caveolin 1, Caveolae Protein, 22kDa (CAV1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Caveolin-1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CAV1 antibody was raised against the N terminal of CAV1
- Purification
- Affinity purified
- Immunogen
- CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
- Top Product
- Discover our top product CAV1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAV1 Blocking Peptide, catalog no. 33R-8458, is also available for use as a blocking control in assays to test for specificity of this CAV1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAV1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Caveolin-1 (CAV1) (Caveolin 1, Caveolae Protein, 22kDa (CAV1))
- Alternative Name
- CAV1 (CAV1 Products)
- Background
- The scaffolding protein CAV1 is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, Signaling Events mediated by VEGFR1 and VEGFR2, Negative Regulation of Transporter Activity, VEGFR1 Specific Signals
-