SELENBP1 antibody (N-Term)
Quick Overview for SELENBP1 antibody (N-Term) (ABIN631129)
Target
See all SELENBP1 AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- N-Term
-
Specificity
- SELENBP1 antibody was raised against the N terminal of SELENBP1
-
Purification
- Affinity purified
-
Immunogen
- SELENBP1 antibody was raised using the N terminal of SELENBP1 corresponding to a region with amino acids MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD
-
-
-
-
Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
SELENBP1 Blocking Peptide, (ABIN5616035), is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SELENBP1 (Selenium Binding Protein 1 (SELENBP1))
-
Alternative Name
- SELENBP1
-
Background
- SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.
-
Molecular Weight
- 52 kDa (MW of target protein)
-
Pathways
- Brown Fat Cell Differentiation
Target
-