BRAP antibody (Middle Region)
-
- Target See all BRAP Antibodies
- BRAP (BRCA1 Associated Protein (BRAP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BRAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BRAP antibody was raised against the middle region of BRAP
- Purification
- Affinity purified
- Immunogen
- BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS
- Top Product
- Discover our top product BRAP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BRAP Blocking Peptide, catalog no. 33R-10166, is also available for use as a blocking control in assays to test for specificity of this BRAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BRAP (BRCA1 Associated Protein (BRAP))
- Alternative Name
- BRAP (BRAP Products)
- Background
- The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.
- Molecular Weight
- 67 kDa (MW of target protein)
-