LIN7C antibody

Catalog No. ABIN631151

The Rabbit Polyclonal anti-LIN7C antibody has been validated for WB. It is suitable to detect LIN7C in samples from Human, Rat and Mouse.

Quick Overview for LIN7C antibody (ABIN631151)

Target: LIN7C (Lin-7 Homolog C (LIN7C))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIN7C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIN7C Antibody

Purification: Affinity purified

Immunogen: LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIN7C Blocking Peptide, (ABIN5614459), is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIN7C

Target: LIN7C (Lin-7 Homolog C (LIN7C))

Alternative Name: LIN7C

Background: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Synaptic Membrane