LIN7C antibody
-
- Target See all LIN7C Antibodies
- LIN7C (Lin-7 Homolog C (LIN7C))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIN7C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV
- Top Product
- Discover our top product LIN7C Primary Antibody
-
anti-Lin-7 Homolog C (LIN7C) (N-Term) antibody
LIN7C Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Bat, Chicken, Hamster, Monkey, Pig WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 168-197), (C-Term) antibodyLIN7C Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB32322 unconjugated
anti-Lin-7 Homolog C (LIN7C) (N-Term) antibodyLIN7C Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish (Danio rerio) WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 108-157) antibodyLIN7C Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish (Danio rerio), Bat, Chicken, Hamster, Monkey, Pig, Xenopus laevis WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 1-70) antibodyLIN7C Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 175-197), (C-Term) antibodyLIN7C Reactivity: Human WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIN7C Blocking Peptide, catalog no. 33R-6031, is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIN7C (Lin-7 Homolog C (LIN7C))
- Alternative Name
- LIN7C (LIN7C Products)
- Background
- LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-
