Epsin 2 antibody (Middle Region)

Catalog No. ABIN631154

The Rabbit Polyclonal anti-Epsin 2 antibody has been validated for WB. It is suitable to detect Epsin 2 in samples from Human, Mouse and Rat.

Quick Overview for Epsin 2 antibody (Middle Region) (ABIN631154)

Target: Epsin 2 (EPN2)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Epsin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Epsin 2 Antibody

Binding Specificity: Middle Region

Specificity: Epsin 2 antibody was raised against the middle region of EPN2

Purification: Affinity purified

Immunogen: Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Epsin 2 Blocking Peptide, (ABIN937487), is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Epsin 2

Target: Epsin 2 (EPN2)

Alternative Name: Epsin 2

Background: EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: EGFR Downregulation