Epsin 2 antibody (Middle Region)
-
- Target See all Epsin 2 (EPN2) Antibodies
- Epsin 2 (EPN2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Epsin 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Epsin 2 antibody was raised against the middle region of EPN2
- Purification
- Affinity purified
- Immunogen
- Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN
- Top Product
- Discover our top product EPN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Epsin 2 Blocking Peptide, catalog no. 33R-2101, is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Epsin 2 (EPN2)
- Alternative Name
- Epsin 2 (EPN2 Products)
- Background
- EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- EGFR Downregulation
-