TKT antibody

Catalog No. ABIN631160

Product Details anti-TKT Antibody

Target: TKT (Transketolase (TKT))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TKT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TKT Blocking Peptide, catalog no. 33R-2753, is also available for use as a blocking control in assays to test for specificity of this TKT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TKT

Target: TKT (Transketolase (TKT))

Alternative Name: TKT (TKT Products)

Synonyms: TK antibody, TKT1 antibody, p68 antibody, Dmel\\CG8036 antibody, anon-WO0118547.344 antibody, cb860 antibody, fb38f03 antibody, fj52f12 antibody, id:ibd3270 antibody, wu:cegs2794 antibody, wu:fb38f03 antibody, wu:fj52f12 antibody, tkt1 antibody, PSPTO0385 antibody, Tb08.11J15.550 antibody, xcc-b100_0966 antibody, transketolase antibody, CG8036 gene product from transcript CG8036-RB antibody, TransKeTolase homolog antibody, transketolase b antibody, transketolase L homeolog antibody, transketolase Tkt antibody, tkt antibody, TKT antibody, Tkt antibody, CG8036 antibody, tkt-1 antibody, tktb antibody, tkt.L antibody, tkt antibody, JK_RS05135 antibody, Tb927.8.6170 antibody, APH_RS01480 antibody

Background: TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.

Molecular Weight: 68 kDa (MW of target protein)