SULT6B1 antibody (C-Term)

Catalog No. ABIN631168

This Rabbit Polyclonal antibody specifically detects SULT6B1 in WB. It exhibits reactivity toward Human.

Quick Overview for SULT6B1 antibody (C-Term) (ABIN631168)

Target: SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT6B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SULT6B1 Antibody

Binding Specificity: C-Term

Specificity: SULT6 B1 antibody was raised against the C terminal of SULT6 1

Purification: Affinity purified

Immunogen: SULT6 B1 antibody was raised using the C terminal of SULT6 1 corresponding to a region with amino acids FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT6B1 Blocking Peptide, (ABIN938347), is also available for use as a blocking control in assays to test for specificity of this SULT6B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT6B1

Target: SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))

Alternative Name: SULT6B1

Background: SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters.

Molecular Weight: 30 kDa (MW of target protein)