ACSBG2 antibody (Middle Region)
-
- Target See all ACSBG2 Antibodies
- ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACSBG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACSBG2 antibody was raised against the middle region of ACSBG2
- Purification
- Affinity purified
- Immunogen
- ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK
- Top Product
- Discover our top product ACSBG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACSBG2 Blocking Peptide, catalog no. 33R-5237, is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSBG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))
- Alternative Name
- ACSBG2 (ACSBG2 Products)
- Background
- ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-