ACSBG2 antibody (Middle Region)

Catalog No. ABIN631171

This Rabbit Polyclonal antibody specifically detects ACSBG2 in WB. It exhibits reactivity toward Human.

Quick Overview for ACSBG2 antibody (Middle Region) (ABIN631171)

Target: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACSBG2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACSBG2 Antibody

Binding Specificity: Middle Region

Specificity: ACSBG2 antibody was raised against the middle region of ACSBG2

Purification: Affinity purified

Immunogen: ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSBG2 Blocking Peptide, (ABIN5611917), is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSBG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACSBG2

Target: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Alternative Name: ACSBG2

Background: ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process