SULT1B1 antibody (N-Term)
-
- Target See all SULT1B1 Antibodies
- SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT1B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT1 B1 antibody was raised against the N terminal of SULT1 1
- Purification
- Affinity purified
- Immunogen
- SULT1 B1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG
- Top Product
- Discover our top product SULT1B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT1B1 Blocking Peptide, catalog no. 33R-6218, is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))
- Alternative Name
- SULT1B1 (SULT1B1 Products)
- Background
- SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.
- Molecular Weight
- 35 kDa (MW of target protein)
-