Peripherin antibody (N-Term)

Catalog No. ABIN631185

This anti-Peripherin antibody is a Rabbit Polyclonal antibody detecting Peripherin in WB. Suitable for Human, Rat and Mouse.

Quick Overview for Peripherin antibody (N-Term) (ABIN631185)

Target: Peripherin (PRPH)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peripherin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Peripherin Antibody

Binding Specificity: N-Term

Specificity: PRPH antibody was raised against the N terminal of PRPH

Purification: Affinity purified

Immunogen: PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPH Blocking Peptide, catalog no. 33R-7897, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peripherin

Target: Peripherin (PRPH)

Alternative Name: PRPH

Background: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

Molecular Weight: 54 kDa (MW of target protein)