IFT122 antibody

Catalog No. ABIN631200

The Rabbit Polyclonal anti-IFT122 antibody (ABIN631200) specifically detects IFT122 in WB. The antibody is reactive with Human samples.

Quick Overview for IFT122 antibody (ABIN631200)

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFT122 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IFT122 Antibody

Purification: Affinity purified

Immunogen: IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFT122 Blocking Peptide, (ABIN5614150), is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFT122

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Alternative Name: IFT122

Background: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Molecular Weight: 129 kDa (MW of target protein)

Pathways: Tube Formation, Embryonic Body Morphogenesis