WDR6 antibody (C-Term)

Catalog No. ABIN631201

This Rabbit Polyclonal antibody specifically detects WDR6 in WB and IHC. It exhibits reactivity toward Human and Mouse.

Quick Overview for WDR6 antibody (C-Term) (ABIN631201)

Target: WDR6 (WD Repeat Domain 6 (WDR6))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-WDR6 Antibody

Binding Specificity: C-Term

Specificity: WDR6 antibody was raised against the C terminal of WDR6

Purification: Affinity purified

Immunogen: WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR6 Blocking Peptide, (ABIN5617001), is also available for use as a blocking control in assays to test for specificity of this WDR6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR6

Target: WDR6 (WD Repeat Domain 6 (WDR6))

Alternative Name: WDR6

Background: WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molecular Weight: 53 kDa (MW of target protein)