UBR1 antibody (N-Term)

Catalog No. ABIN631210

This Rabbit Polyclonal antibody specifically detects UBR1 in WB. It exhibits reactivity toward Human.

Quick Overview for UBR1 antibody (N-Term) (ABIN631210)

Target: UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBR1 Antibody

Binding Specificity: N-Term

Specificity: UBR1 antibody was raised against the N terminal of UBR1

Purification: Affinity purified

Immunogen: UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBR1 Blocking Peptide, (ABIN936122), is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBR1

Target: UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))

Alternative Name: UBR1

Background: UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Molecular Weight: 200 kDa (MW of target protein)