AASDHPPT antibody (C-Term)

Catalog No. ABIN631211

The Rabbit Polyclonal anti-AASDHPPT antibody is suitable to detect AASDHPPT in samples from Human. It has been validated for WB.

Quick Overview for AASDHPPT antibody (C-Term) (ABIN631211)

Target: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AASDHPPT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AASDHPPT Antibody

Binding Specificity: C-Term

Specificity: AASDHPPT antibody was raised against the C terminal of AASDHPPT

Purification: Affinity purified

Immunogen: AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AASDHPPT Blocking Peptide, (ABIN5611849), is also available for use as a blocking control in assays to test for specificity of this AASDHPPT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDHPPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AASDHPPT

Target: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Alternative Name: AASDHPPT

Background: AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Molecular Weight: 36 kDa (MW of target protein)