COTL1 antibody
-
- Target See all COTL1 Antibodies
- COTL1 (Coactosin-Like Protein)
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COTL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ
- Top Product
- Discover our top product COTL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COTL1 (Coactosin-Like Protein)
- Alternative Name
- Coactosin-Like 1 (COTL1 Products)
- Synonyms
- CLP antibody, 1810074P22Rik antibody, 2010004C08Rik antibody, Clp antibody, coactosin like F-actin binding protein 1 antibody, coactosin-like 1 (Dictyostelium) antibody, coactosin-like F-actin binding protein 1 antibody, COTL1 antibody, Cotl1 antibody
- Background
- This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.
- Molecular Weight
- 16 kDa (MW of target protein)
-