COTL1 antibody

Catalog No. ABIN631212

Product Details anti-COTL1 Antibody

Target: COTL1 (Coactosin-Like Protein)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COTL1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COTL1

Target: COTL1 (Coactosin-Like Protein)

Alternative Name: Coactosin-Like 1 (COTL1 Products)

Synonyms: CLP antibody, 1810074P22Rik antibody, 2010004C08Rik antibody, Clp antibody, coactosin like F-actin binding protein 1 antibody, coactosin-like 1 (Dictyostelium) antibody, coactosin-like F-actin binding protein 1 antibody, COTL1 antibody, Cotl1 antibody

Background: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.

Molecular Weight: 16 kDa (MW of target protein)