Mahogunin RING Finger Protein 1 antibody (Middle Region)
-
- Target See all Mahogunin RING Finger Protein 1 (MGRN1) Antibodies
- Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Mahogunin RING Finger Protein 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MGRN1 antibody was raised against the middle region of MGRN1
- Purification
- Affinity purified
- Immunogen
- MGRN1 antibody was raised using the middle region of MGRN1 corresponding to a region with amino acids EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS
- Top Product
- Discover our top product MGRN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGRN1 Blocking Peptide, catalog no. 33R-2492, is also available for use as a blocking control in assays to test for specificity of this MGRN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGRN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))
- Alternative Name
- MGRN1 (MGRN1 Products)
- Synonyms
- RNF156 antibody, 2610042J20Rik antibody, mKIAA0544 antibody, md antibody, nc antibody, RGD1311862 antibody, mgrn1 antibody, wu:fi38c03 antibody, zgc:55978 antibody, mahogunin ring finger 1 antibody, mahogunin, ring finger 1 antibody, mahogunin ring finger 1, E3 ubiquitin protein ligase S homeolog antibody, mahogunin ring finger 1, E3 ubiquitin protein ligase antibody, mahogunin, ring finger 1a antibody, MGRN1 antibody, Mgrn1 antibody, mgrn1.S antibody, mgrn1 antibody, mgrn1a antibody
- Background
- Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-